| 产品详情 |
| Edit |   |
| Antigenic Specificity | Semaphorin 3A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Semaphorin 3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Semaphorin 3A. This antibody reacts with human. The Semaphorin 3A Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Semaphorin 3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL |
| Other Names | (semaphorin) 3A, coll-1, collapsin 1, Hsema-I, Hsema-III, MGC133243, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, Sema III, SEMA1, SEMAD, SEMAIII, SEMAL, semaphorin D, Semaphorin III, semaphorin L, semaphorin-3A, SemD |
| Gene, Accession # | SEMA3A, Gene ID: 10371 |
| Catalog # | NBP2-56804 |
| Price | |
| Order / More Info | Semaphorin 3A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|