| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SEMA3D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 28320475). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SEMA3D Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEMA3D. This antibody reacts with human. The SEMA3D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SEMA3D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVG |
|---|
| Other Names | (semaphorin) 3D, coll-2, collapsin 2, MGC39708, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, semaphorin-3D, Sema-Z2 |
|---|
| Gene, Accession # | SEMA3D, Gene ID: 223117 |
|---|
| Catalog # | NBP1-85517 |
|---|
| Price | |
|---|
| Order / More Info | SEMA3D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23372769, 28320475 |
|---|
| 产品资料 |
|
|