| 产品详情 |
| Edit |   |
| Antigenic Specificity | SELM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB reported in the scientific literature (PMID: 23880772). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SELM Antibody from Novus Biologicals is a rabbit polyclonal antibody to SELM. This antibody reacts with human, mouse. The SELM Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SELM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHA |
| Other Names | MGC40146, selenoprotein M, selenoprotein SelM, SEPM |
| Gene, Accession # | SELM, Gene ID: 140606 |
| Catalog # | NBP1-90883 |
| Price | |
| Order / More Info | SELM Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23880772, 24519931 |
| 产品资料 |
|
|