| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NF-L |
|---|
| Clone | CL4729 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NF-L Antibody (CL4729) from Novus Biologicals is a mouse monoclonal antibody to NF-L. This antibody reacts with human, mouse, rat. The NF-L Antibody (CL4729) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NF-L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF |
|---|
| Other Names | 68 kDa neurofilament protein, neurofilament protein, light chain, neurofilament subunit NF-L, Neurofilament triplet L protein, neurofilament, light polypeptide, neurofilament-light, NF68FLJ53642, NF-L, NFLlight polypeptide 68kDa |
|---|
| Gene, Accession # | NEFL, Gene ID: 4747 |
|---|
| Catalog # | NBP2-59061 |
|---|
| Price | |
|---|
| Order / More Info | NF-L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|