| Edit |   |
|---|
| Antigenic Specificity | Sodium Calcium Exchanger 1/NCX1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sodium Calcium Exchanger 1/NCX1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sodium Calcium Exchanger 1/NCX1. This antibody reacts with human. The Sodium Calcium Exchanger 1/NCX1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Sodium Calcium Exchanger 1/NCX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE |
|---|
| Other Names | FLJ37694, FLJ43417, Na(+)/Ca(2+)-exchange protein 1, sodium/calcium exchanger 1, solute carrier family 8 (sodium/calcium exchanger), member 1 |
|---|
| Gene, Accession # | SLC8A1, Gene ID: 6546 |
|---|
| Catalog # | NBP2-56483 |
|---|
| Price | |
|---|
| Order / More Info | Sodium Calcium Exchanger 1/NCX1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|