| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sodium-Calcium Exchanger |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sodium-Calcium Exchanger Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sodium-Calcium Exchanger. This antibody reacts with human. The Sodium-Calcium Exchanger Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC8A3(solute carrier family 8 (sodium-calcium exchanger), member 3) The peptide sequence was selected from the N terminal of Sodium-Calcium Exchanger. Peptide sequence SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE. |
|---|
| Other Names | Na(+)/Ca(2+)-exchange protein 3, Na+/Ca2+ exchanger 3, NCX3sodium/calcium exchanger SLC8A3, sodium/calcium exchanger 3, solute carrier family 8 (sodium/calcium exchanger), member 3, solute carrier family 8 (sodium-calcium exchanger), member 3 |
|---|
| Gene, Accession # | SLC8A3, Gene ID: 6547, Accession: Q96QG2, SwissProt: Q96QG2 |
|---|
| Catalog # | NBP1-69515 |
|---|
| Price | |
|---|
| Order / More Info | Sodium-Calcium Exchanger Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|