| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Gamma Adaptin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Gamma Adaptin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Gamma Adaptin. This antibody reacts with human. The Gamma Adaptin Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated. Specificity of human Gamma Adaptin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTI |
|---|
| Other Names | Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, adaptor-related protein complex 1, gamma 1 subunit, ADTGclathrin assembly protein complex 1 gamma large chain, AP-1 complex subunit gamma-1, CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1, Clathrin assembly protein complex 1 gamma-1 large chain, gamma adaptin, gamma1-adaptin, golgi adaptor HA1/AP1 adaptin gamma subunit, Golgi adaptor HA1/AP1 adaptin subunit gamma-1, MGC18255 |
|---|
| Gene, Accession # | AP1G1, Gene ID: 164 |
|---|
| Catalog # | NBP2-58947 |
|---|
| Price | |
|---|
| Order / More Info | Gamma Adaptin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|