| Edit |   |
| Antigenic Specificity | KRTAP23-1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KRTAP23-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KRTAP23-1. This antibody reacts with human. The KRTAP23-1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KRTAP23-1 (keratin associated protein 23-1) The peptide sequence was selected from the middle region of KRTAP23-1. Peptide sequence CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN. |
| Other Names | KAP23.1keratin-associated protein 23-1, keratin associated protein 23-1 |
| Gene, Accession # | KRTAP23-1, Gene ID: 337963 |
| Catalog # | NBP1-70596-20ul |
| Price | |
| Order / More Info | KRTAP23-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |