| 产品详情 |
| Edit |   |
| Antigenic Specificity | PUS10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PUS10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PUS10. This antibody reacts with human. The PUS10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PUS10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNKQSVFTRMAVMKA |
| Other Names | CCDC139, coiled-coil domain containing 139, Coiled-coil domain-containing protein 139, DOBIMGC126729, EC 5.4.99, EC 5.4.99.-, FLJ32312, MGC126755, pseudouridine synthase 10, pseudouridylate synthase 10, Psi55 synthase, PUS1, putative tRNA pseudouridine synthase Pus10, tRNA pseudouridine 55 synthase, tRNA pseudouridylate synthase, tRNA-uridine isomerase |
| Gene, Accession # | PUS10, Gene ID: 150962, Accession: Q3MIT2, SwissProt: Q3MIT2 |
| Catalog # | NBP2-30613 |
| Price | |
| Order / More Info | PUS10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|