| 产品详情 |
| Edit |   |
| Antigenic Specificity | MYOM1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MYOM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MYOM1. This antibody reacts with human. The MYOM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MYOM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FDETRFHAGASTMPLSFGVTPYGYASRFEIHFDDKFDVSFGREGETMSLGCRVVITPEIKHFQPEIQWYRNGVPLSPSKWVQTLWSGERATLTFSHLNKE |
| Other Names | 190 kDa connectin-associated protein, 190 kDa titin-associated protein, EH-myomesin, MGC134946, MGC134947, myomesin (M-protein) 1 (190kD), myomesin 1 (skelemin) (185kD), myomesin 1 (skelemin) 185kDa, myomesin 1, 185kDa, Myomesin family member 1, myomesin-1, SKELEMIN |
| Gene, Accession # | MYOM1, Gene ID: 8736, Accession: P52179, SwissProt: P52179 |
| Catalog # | NBP2-38603 |
| Price | |
| Order / More Info | MYOM1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|