| Edit |   |
|---|
| Antigenic Specificity | EDA2R/TNFRSF27/XEDAR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EDA2R/TNFRSF27/XEDAR Antibody from Novus Biologicals is a rabbit polyclonal antibody to EDA2R/TNFRSF27/XEDAR. This antibody reacts with human. The EDA2R/TNFRSF27/XEDAR Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human EDA2R/TNFRSF27/XEDAR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHKCQSCITCAVINRVQKVNCTATS |
|---|
| Other Names | ectodysplasin A2 receptor, EDA-A2 receptor, EDA-A2R, EDAA2Rtumor necrosis factor receptor superfamily member XEDAR, EDAR2, XEDARTNFRSF27tumor necrosis factor receptor superfamily member 27, X-linked ectodysplasin-A2 receptor |
|---|
| Gene, Accession # | EDA2R, Gene ID: 60401 |
|---|
| Catalog # | NBP2-58618 |
|---|
| Price | |
|---|
| Order / More Info | EDA2R/TNFRSF27/XEDAR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|