| Edit |   |
| Antigenic Specificity | LIAT1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LIAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LIAT1. This antibody reacts with human. The LIAT1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC400566(hypothetical gene supported by AK128660) The peptide sequence was selected from the N terminal of LOC400566. Peptide sequence VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL. |
| Other Names | chromosome 17 open reading frame 97, hypothetical protein LOC400566 |
| Gene, Accession # | C17orf97, Gene ID: 400566 |
| Catalog # | NBP1-70443-20ul |
| Price | |
| Order / More Info | LIAT1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |