| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | L3HYPDH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The L3HYPDH Antibody from Novus Biologicals is a rabbit polyclonal antibody to L3HYPDH. This antibody reacts with human. The L3HYPDH Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human L3HYPDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPRGHRDMYGAVLVPSEL |
|---|
| Other Names | C14orf149, chromosome 14 open reading frame 149, EC 5.1.1.4, FLJ25436, probable proline racemase, proline racemase-like |
|---|
| Gene, Accession # | L3HYPDH, Gene ID: 112849, Accession: Q96EM0, SwissProt: Q96EM0 |
|---|
| Catalog # | NBP2-31648 |
|---|
| Price | |
|---|
| Order / More Info | L3HYPDH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|