| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LHX6 |
|---|
| Clone | 3D9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. Immunohistochemistry-Frozen and Immunocytochemistry/Immunofluorescence were reported in scientific literature (PMID 19906869 ). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LHX6 Antibody (3D9) from Novus Biologicals is a mouse monoclonal antibody to LHX6. This antibody reacts with human, mouse, rat. The LHX6 Antibody (3D9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | LHX6 (NP_055183, 274 a.a. 363a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY |
|---|
| Other Names | LHX6.1LIM homeobox protein 6, LIM homeobox 6, LIM homeodomain protein 6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1, MGC119542, MGC119544, MGC119545 |
|---|
| Gene, Accession # | LHX6, Gene ID: 26468, Accession: NP_055183, SwissProt: NP_055183 |
|---|
| Catalog # | H00026468-M01 |
|---|
| Price | |
|---|
| Order / More Info | LHX6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19906869 |
|---|
| 产品资料 |
|
|