| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LHX6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Alexa Fluor 750 conjugate |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunofluorescence. Optimal dilution of this antibody should be experimentally determined. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LHX6 Antibody [Alexa Fluor® 750] from Novus Biologicals is a rabbit polyclonal antibody to LHX6. This antibody reacts with human. The LHX6 Antibody [Alexa Fluor® 750] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunofluorescence. Specificity: LHX6 |
|---|
| Immunogen | Synthetic peptide corresponding to a region of human LHX6 with an internal ID of P03556; LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. |
|---|
| Other Names | LHX6.1LIM homeobox protein 6, LIM homeobox 6, LIM homeodomain protein 6.1, LIM/homeobox protein Lhx6, LIM/homeobox protein Lhx6.1, MGC119542, MGC119544, MGC119545 |
|---|
| Gene, Accession # | LHX6, Gene ID: 26468 |
|---|
| Catalog # | NB200-526AF750 |
|---|
| Price | |
|---|
| Order / More Info | LHX6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|