| Edit |   |
| Antigenic Specificity | Arylsulfatase G/ARSG |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Arylsulfatase G/ARSG Antibody from Novus Biologicals is a rabbit polyclonal antibody to Arylsulfatase G/ARSG. This antibody reacts with mouse. The Arylsulfatase G/ARSG Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Arsg. Peptide sequence GRDVSEVLFGKSQMGHRVLFHPNSGAAGEYGALQTVRLNHYKAFYITGGA. |
| Other Names | arylsulfatase G, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.4, KIAA1001ASG |
| Gene, Accession # | ARSG, Gene ID: 22901, Accession: NP_082986 |
| Catalog # | NBP1-79576 |
| Price | |
| Order / More Info | Arylsulfatase G/ARSG Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |