| Edit |   |
|---|
| Antigenic Specificity | Arylsulfatase G/ARSG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Arylsulfatase G/ARSG Antibody from Novus Biologicals is a rabbit polyclonal antibody to Arylsulfatase G/ARSG. This antibody reacts with mouse. The Arylsulfatase G/ARSG Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Arsg. Peptide sequence GRDVSEVLFGKSQMGHRVLFHPNSGAAGEYGALQTVRLNHYKAFYITGGA. |
|---|
| Other Names | arylsulfatase G, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.4, KIAA1001ASG |
|---|
| Gene, Accession # | ARSG, Gene ID: 22901, Accession: NP_082986 |
|---|
| Catalog # | NBP1-79576-20ul |
|---|
| Price | |
|---|
| Order / More Info | Arylsulfatase G/ARSG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|