| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALS2CR15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALS2CR15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALS2CR15. This antibody reacts with human. The ALS2CR15 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ICA1L(islet cell autoantigen 1,69kDa-like) The peptide sequence was selected from the middle region of ICA1L. Peptide sequence PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA. |
|---|
| Other Names | ALS2CR14, ALS2CR15, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 14, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein, candidate 15, DKFZp434E1919, Ica69-related protein, islet cell autoantigen 1,69kDa-like, islet cell autoantigen 1-like protein, MGC138440 |
|---|
| Gene, Accession # | ICA1L, Gene ID: 130026, Accession: Q8NDH6, SwissProt: Q8NDH6 |
|---|
| Catalog # | NBP1-56711-20ul |
|---|
| Price | |
|---|
| Order / More Info | ALS2CR15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|