| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALS2CR15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALS2CR15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALS2CR15. This antibody reacts with human. The ALS2CR15 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ALS2CR15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPSASLTSQEPSMGSEPLAHSSRFLPSQLFDLGFHVAGAFNNWVSQEESELCLSHTDNQPVPSQSPKKLTRSPNNGNQD |
|---|
| Other Names | ALS2CR14, ALS2CR15, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 14, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein, candidate 15, DKFZp434E1919, Ica69-related protein, islet cell autoantigen 1,69kDa-like, islet cell autoantigen 1-like protein, MGC138440 |
|---|
| Gene, Accession # | ICA1L, Gene ID: 130026, Accession: Q8NDH6, SwissProt: Q8NDH6 |
|---|
| Catalog # | NBP1-90185 |
|---|
| Price | |
|---|
| Order / More Info | ALS2CR15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|