| Edit |   |
|---|
| Antigenic Specificity | ALS2CR12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALS2CR12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALS2CR12. This antibody reacts with human. The ALS2CR12 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ALS2CR12(amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12) The peptide sequence was selected from the N terminal of ALS2CR12. Peptide sequence SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSAR |
|---|
| Other Names | amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 |
|---|
| Gene, Accession # | ALS2CR12, Gene ID: 130540 |
|---|
| Catalog # | NBP1-70405 |
|---|
| Price | |
|---|
| Order / More Info | ALS2CR12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|