| Edit |   |
|---|
| Antigenic Specificity | ALS2CR12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALS2CR12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALS2CR12. This antibody reacts with human. The ALS2CR12 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ALS2CR12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR |
|---|
| Other Names | amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 |
|---|
| Gene, Accession # | ALS2CR12, Gene ID: 130540, Accession: Q96Q35, SwissProt: Q96Q35 |
|---|
| Catalog # | NBP1-85902 |
|---|
| Price | |
|---|
| Order / More Info | ALS2CR12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|