Edit |   |
Antigenic Specificity | RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. |
Immunogen | RG9 MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE |
Other Names | RG9MTD1|rg9mtd1|wu:fb53e06|zgc:103570|HNYA|MRPP1|Rg9mtd1|1300018J16Rik|D16Ertd454e|Rnmtd1 |
Gene, Accession # | Gene ID: 54931 |
Catalog # | ABIN633378 |
Price | |
Order / More Info | RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |