| Edit |   |
|---|
| Antigenic Specificity | Complement C4b |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Complement C4b antibody |
|---|
| Immunogen | Complement C4b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
|---|
| Other Names | complement C4-B preproprotein; Complement C4-B; complement C4-B; complement component 4B (Chido blood group); Basic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3, C4B; C4B; CH; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4BD; C4B12; C4B_2; CPAMD3; CO4; CPAMD3 |
|---|
| Gene, Accession # | Gene ID: 721, NCBI: NP_001002029.3 |
|---|
| Catalog # | MBS839274 |
|---|
| Price | |
|---|
| Order / More Info | Complement C4b Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|