| Edit |   |
|---|
| Antigenic Specificity | Bradykinin Receptor B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Bradykinin Receptor B2 antibody. Specificity: Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2 |
|---|
| Immunogen | Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV |
|---|
| Other Names | Bradykinin Receptor B2; Bradykinin Receptor B2; BK2; BKNRB2; BKR2; BRB2; DKFZp686O088; B2R; BK-2, |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | MBS5301481 |
|---|
| Price | |
|---|
| Order / More Info | Bradykinin Receptor B2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|