| 产品详情 |
| Edit |   |
| Antigenic Specificity | Junctional Adhesion Molecule 3 (JAM3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. |
| Immunogen | JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ |
| Other Names | JAM3|jam3|sr:nyz155|wu:fb30h11|wu:fc08c06|wu:fc13e04|wu:fc25g11|jamc.2|1110002N23Rik|JAM-3|JAM-C|Jcam3|JAM-2|JAMC |
| Gene, Accession # | Gene ID: 83700,83964 |
| Catalog # | ABIN635598 |
| Price | |
| Order / More Info | Junctional Adhesion Molecule 3 (JAM3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 产品资料 |
|
|