Edit |   |
Antigenic Specificity | delta-Like 1 Homolog (Drosophila) (DLK1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | DLK1 may have a role in neuroendocrine differentiation. |
Immunogen | DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
Other Names | DLK|DLK-1|Delta1|FA1|PREF1|Pref-1|ZOG|pG2|AW742678|DlkI|Ly107|Peg9|SCP1|pref-1|Zog |
Gene, Accession # | Gene ID: 8788,13386,114587 |
Catalog # | ABIN635854 |
Price | |
Order / More Info | delta-Like 1 Homolog (Drosophila) (DLK1) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |