| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NEI3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NEI3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEI3. This antibody reacts with human. The NEI3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NEI3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC |
|---|
| Other Names | DNA glycosylase FPG2, DNA glycosylase hFPG2, DNA glycosylase/AP lyase Neil3, EC 3.2.2.-, EC 4.2.99.18, endonuclease 8-like 3, Endonuclease VIII-like 3, FGP2, FLJ10858, FPG2, hFPG2, hNEI3, nei endonuclease VIII-like 3 (E. coli), NEI3, Nei-like protein 3 |
|---|
| Gene, Accession # | NEIL3, Gene ID: 55247 |
|---|
| Catalog # | NBP2-56282 |
|---|
| Price | |
|---|
| Order / More Info | NEI3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|