Edit |   |
Antigenic Specificity | Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown. |
Immunogen | ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH |
Other Names | LRRC62|PPP1R29|dJ63G5.3|Elfn2|RGD1559693|6330514E13|AW048948|BC094219|Lrrc62|Ppp1r29 |
Gene, Accession # | Gene ID: 114794,207393,315117 |
Catalog # | ABIN635494 |
Price | |
Order / More Info | Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |