| 产品详情 |
| Edit |   |
| Antigenic Specificity | TIP120A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TIP120A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIP120A. This antibody reacts with human. The TIP120A Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human TIP120A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEI |
| Other Names | cullin-associated and neddylation-dissociated 1, Cullin-associated and neddylation-dissociated protein 1, cullin-associated NEDD8-dissociated protein 1, DKFZp434M1414, FLJ90441, KIAA0829FLJ10114, p120 CAND1, TBP interacting protein, TBP-interacting protein 120A, TBP-interacting protein of 120 kDa A, TIP120AFLJ38691, TIP120FLJ10929 |
| Gene, Accession # | CAND1, Gene ID: 55832 |
| Catalog # | NBP2-56630 |
| Price | |
| Order / More Info | TIP120A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|