| Edit |   |
|---|
| Antigenic Specificity | Microfibrillar Associated Protein 2 (MFAP2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. |
|---|
| Immunogen | MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY |
|---|
| Other Names | MAGP|MAGP-1|MAGP1|AI893631|Magp|Magp1 |
|---|
| Gene, Accession # | Gene ID: 4237,17150,313662 |
|---|
| Catalog # | ABIN634025 |
|---|
| Price | |
|---|
| Order / More Info | Microfibrillar Associated Protein 2 (MFAP2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|