Edit |   |
Antigenic Specificity | Ribosomal Protein L5 (RPL5) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, Arabidopsis, Drosophila |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA. |
Immunogen | RPL5 antibody was raised using the N terminal of RPL5 corresponding to a region with amino acids RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP |
Other Names | DBA6|L5|U21RNA|CG17489|Dmel\\CG17489|E-2d|M(2)40B|Rp L5|Rpl5|dRPL5|yip6|rpl5|wu:fj02g05|zgc:86854 |
Gene, Accession # | Gene ID: 3355124,6125,100503670,81763 |
Catalog # | ABIN633202 |
Price | |
Order / More Info | Ribosomal Protein L5 (RPL5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |