| Edit |   |
|---|
| Antigenic Specificity | PTPLAD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PTPLAD2 antibody. Specificity: PTPLAD2 antibody was raised against the middle region of PTPLAD2 |
|---|
| Immunogen | PTPLAD2 antibody was raised using the middle region of PTPLAD2 corresponding to a region with amino acids LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW |
|---|
| Other Names | PTPLAD2 protein; Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4; very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4; 3-hydroxyacyl-CoA dehydratase 4; 3-hydroxyacyl-CoA dehydratase 4, HACD4; HACD4; PTPLAD2; HACD4 |
|---|
| Gene, Accession # | PTPLAD2, Gene ID: 401494, NCBI: AAI14216.1 |
|---|
| Catalog # | MBS5301844 |
|---|
| Price | |
|---|
| Order / More Info | PTPLAD2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|