Edit |   |
Antigenic Specificity | Kelch-Like 2, Mayven (Drosophila) (KLHL2) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells. |
Immunogen | KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN |
Other Names | 6030411N21Rik|ABP-KELCH|AU020744|Mav|mKIAA4249|MAV|MAYVEN |
Gene, Accession # | Gene ID: 11275 |
Catalog # | ABIN633041 |
Price | |
Order / More Info | Kelch-Like 2, Mayven (Drosophila) (KLHL2) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |