| Edit |   |
|---|
| Antigenic Specificity | TUSC5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TUSC5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TUSC5. This antibody reacts with human. The TUSC5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TUSC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQE |
|---|
| Other Names | IFITMD3located at seventeen p thirteen point three 1, Interferon-induced transmembrane domain-containing protein D3, LOST1interferon induced transmembrane protein domain containing 3, Protein located at seventeen-p-thirteen point three 1, tumor suppressor candidate 5 |
|---|
| Gene, Accession # | TUSC5, Gene ID: 286753 |
|---|
| Catalog # | NBP2-48982 |
|---|
| Price | |
|---|
| Order / More Info | TUSC5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|