Edit |   |
Antigenic Specificity | WBP2 N-terminal Like (WBP2NL) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization. |
Immunogen | WBP2 NL antibody was raised using the N terminal of WBP2 L corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT |
Other Names | pawp|PAWP|4930521I23Rik |
Gene, Accession # | Gene ID: 164684 |
Catalog # | ABIN630989 |
Price | |
Order / More Info | WBP2 N-terminal Like (WBP2NL) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |