| Edit |   |
|---|
| Antigenic Specificity | TUSC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TUSC1 antibody. Specificity: TUSC1 antibody was raised against the middle region of TUSC1 |
|---|
| Immunogen | TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL |
|---|
| Other Names | tumor suppressor candidate gene 1 protein; Tumor suppressor candidate gene 1 protein; tumor suppressor candidate gene 1 protein; tumor suppressor candidate 1; TSG-9; TSG9, TUSC1; TUSC1; TSG9; TSG-9; TSG9 |
|---|
| Gene, Accession # | TUSC1, Gene ID: 286319, NCBI: NP_001004125.1 |
|---|
| Catalog # | MBS5300530 |
|---|
| Price | |
|---|
| Order / More Info | TUSC1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|