| Edit |   |
|---|
| Antigenic Specificity | Mov10, Moloney Leukemia Virus 10, Homolog (Mouse) (MOV10) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MOV10 may be an helicase with an important function in development and/or control of cell proliferation. |
|---|
| Immunogen | MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR |
|---|
| Other Names | C77703|Mov-10|Capza1|fSAP113|gb110 |
|---|
| Gene, Accession # | Gene ID: 4343 |
|---|
| Catalog # | ABIN629879 |
|---|
| Price | |
|---|
| Order / More Info | Mov10, Moloney Leukemia Virus 10, Homolog (Mouse) (MOV10) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|