| Edit |   |
| Antigenic Specificity | CPNE5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CPNE5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPNE5. This antibody reacts with mouse. The CPNE5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human Cpne5The immunogen for this antibody is Cpne5. Peptide sequence SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ. |
| Other Names | copine VKIAA1599CPN5COPN5, copine-5, DKFZp666C234 |
| Gene, Accession # | CPNE5, Gene ID: 57699, Accession: NP_694806 |
| Catalog # | NBP1-79677 |
| Price | |
| Order / More Info | CPNE5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |