| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Munc18-1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Munc18-1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | syntaxin-binding protein 1 isoform b; Syntaxin-binding protein 1; syntaxin-binding protein 1; syntaxin binding protein 1; MUNC18-1; N-Sec1; Protein unc-18 homolog 1; Unc18-1; Protein unc-18 homolog A; Unc-18A; p67, STXBP1; STXBP1; P67; NSEC1; UNC18; RBSEC1; MUNC18-1; UNC18A; Unc18-1; Unc-18A |
|---|
| Gene, Accession # | Gene ID: 6812, NCBI: NP_001027392.1, UniProt: P61764 |
|---|
| Catalog # | MBS177686 |
|---|
| Price | |
|---|
| Order / More Info | Munc18-1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: STXBP1 syntaxin binding protein 1. 2. Fisher, R. J., Pevsner, J., Burgoyne, R. D. Control of fusion pore dynamics during exocytosis by Munc18. Science 291: 875-878, 2001. 3. Swanson DA, Steel JM, Valle D (Jun 1998). Identification and characterization of the human ortholog of rat STXBP1, a protein implicated in vesicle trafficking and neurotransmitter release. Genomics 48 (3): 373-6. |
|---|
| 产品资料 |
|
|