Edit |   |
Antigenic Specificity | CUGBP, Elav-Like Family Member 5 (CELF5) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene. |
Immunogen | BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP |
Other Names | BRUNOL-5|BRUNOL5|CELF-5|4930565A21Rik|Brunol5|RGD1565016 |
Gene, Accession # | Gene ID: 60680 |
Catalog # | ABIN633506 |
Price | |
Order / More Info | CUGBP, Elav-Like Family Member 5 (CELF5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |