| Edit |   |
| Antigenic Specificity | Magnesium-Dependent Phosphatase 1 (MDP1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase. |
| Immunogen | MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE |
| Other Names | MGC133592|FN6PASE|MDP-1|1810034K20Rik|AI035604|Mdp-1|RGD1311147 |
| Gene, Accession # | Gene ID: 145553 |
| Catalog # | ABIN632094 |
| Price | |
| Order / More Info | Magnesium-Dependent Phosphatase 1 (MDP1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |