| Edit |   |
|---|
| Antigenic Specificity | PCGF6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PCGF6 Antibody |
|---|
| Immunogen | The immunogen for anti-PCGF6 antibody: synthetic peptide directed towards the middle region of human PCGF6. Synthetic peptide located within the following region: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ |
|---|
| Other Names | MBLR, RNF134, polycomb group ring finger 6 |
|---|
| Gene, Accession # | PCGF6, Accession: NM_032154 |
|---|
| Catalog # | TA330481 |
|---|
| Price | |
|---|
| Order / More Info | PCGF6 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|