| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACOX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACOX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACOX2. This antibody reacts with human. The ACOX2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ACOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQN |
|---|
| Other Names | 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA 24-hydroxylase, 12-alpha-trihydroxy-5-beta-cholestanoyl-CoA oxidase, 3-alpha, 7-alpha, acyl-CoA oxidase 2, branched chain, acyl-Coenzyme A oxidase 2, branched chain, BCOX, BRCACOXTHCA-CoA oxidase, BRCOX, EC 1.17.99.3, peroxisomal acyl-coenzyme A oxidase 2,3-alpha, peroxisomal branched chain acyl-CoA oxidase, THCCox, Trihydroxycoprostanoyl-CoA oxidase |
|---|
| Gene, Accession # | ACOX2, Gene ID: 8309 |
|---|
| Catalog # | NBP1-88364 |
|---|
| Price | |
|---|
| Order / More Info | ACOX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|