| Edit |   |
|---|
| Antigenic Specificity | Zymogen Granule Protein 16 (ZG16) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN. |
|---|
| Immunogen | ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG |
|---|
| Other Names | JCLN|JCLN1|ZG16A|Zg-16p|Zg16p|1810010M01Rik|AI593689|ZG16p |
|---|
| Gene, Accession # | Gene ID: 653808 |
|---|
| Catalog # | ABIN634014 |
|---|
| Price | |
|---|
| Order / More Info | Zymogen Granule Protein 16 (ZG16) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|