| Edit |   |
|---|
| Antigenic Specificity | Like-Glycosyltransferase (LARGE) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene, which is one of the largest in the human genome, encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan. |
|---|
| Immunogen | LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE |
|---|
| Other Names | NV15834|DKFZp459G0120|LARGE|MDC1D|MDDGA6|MDDGB6|BPFD36|Gyltl1a|Mbp-1|Mbp1|enr|fg|froggy|mKIAA0609|myd|gyltl1b|gyltl1b-b|mdc1d |
|---|
| Gene, Accession # | Gene ID: 9215 |
|---|
| Catalog # | ABIN635429 |
|---|
| Price | |
|---|
| Order / More Info | Like-Glycosyltransferase (LARGE) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|