| Edit |   |
| Antigenic Specificity | LRDD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRDD Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRDD. This antibody reacts with human. The LRDD Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRDD(leucine-rich repeats and death domain containing) The peptide sequence was selected from the middle region of LRDD. Peptide sequence RRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE. |
| Other Names | leucine-rich repeat and death domain-containing protein, leucine-rich repeats and death domain containing, MGC16925, p53-induced protein with a death domain, PIDD |
| Gene, Accession # | PIDD, Gene ID: 55367, Accession: Q9HB75-3, SwissProt: Q9HB75-3 |
| Catalog # | NBP1-57990-20ul |
| Price | |
| Order / More Info | LRDD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |