| Edit |   |
|---|
| Antigenic Specificity | Dfna5 deafness |
|---|
| Clone | 1E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dfna5 deafness Antibody (1E10) from Novus Biologicals is a mouse monoclonal antibody to Dfna5 deafness. This antibody reacts with human. The Dfna5 deafness Antibody (1E10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | DFNA5 (NP_004394.1 111 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN |
|---|
| Other Names | deafness, autosomal dominant 5, ICERE1, ICERE-1nonsyndromic hearing impairment protein, Inversely correlated with estrogen receptor expression 1, non-syndromic hearing impairment protein 5 |
|---|
| Gene, Accession # | DFNA5, Gene ID: 1687, Accession: NP_004394, SwissProt: NP_004394 |
|---|
| Catalog # | H00001687-M01 |
|---|
| Price | |
|---|
| Order / More Info | Dfna5 deafness Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|