| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DFF40/CAD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DFF40/CAD Antibody from Novus Biologicals is a rabbit polyclonal antibody to DFF40/CAD. This antibody reacts with human. The DFF40/CAD Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DFF40/CAD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN |
|---|
| Other Names | CADCaspase-activated nuclease, Caspase-activated deoxyribonuclease, Caspase-activated DNase, CPANDNA fragmentation factor 40 kDa subunit, DFF-40DFF40DFF2DNA fragmentation factor subunit beta, DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase), EC 3.- |
|---|
| Gene, Accession # | DFFB, Gene ID: 1677 |
|---|
| Catalog # | NBP2-55648 |
|---|
| Price | |
|---|
| Order / More Info | DFF40/CAD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|