| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MYCL1/L-Myc |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MYCL1/L-Myc Antibody from Novus Biologicals is a rabbit polyclonal antibody to MYCL1/L-Myc. This antibody reacts with human. The MYCL1/L-Myc Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human MYCL1/L-Myc antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS |
|---|
| Other Names | BHLHE38, bHLHe38myc-related gene from lung cancer, Class E basic helix-loop-helix protein 38, LMYCl-myc-1 proto-oncogene, MYCL, protein L-Myc-1, v-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived, v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) |
|---|
| Gene, Accession # | MYCL1, Gene ID: 4610 |
|---|
| Catalog # | NBP2-55735 |
|---|
| Price | |
|---|
| Order / More Info | MYCL1/L-Myc Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|