| Edit |   |
|---|
| Antigenic Specificity | Apoptosis enhancing nuclease |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. For ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Apoptosis enhancing nuclease Antibody from Novus Biologicals is a rabbit polyclonal antibody to Apoptosis enhancing nuclease. This antibody reacts with human. The Apoptosis enhancing nuclease Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLP TPFGAATATEAASSGKQCLRAGSGSAP |
|---|
| Other Names | apoptosis enhancing nuclease, EC 3.1, EC 3.1.13.1, FLJ12484, FLJ12562, interferon stimulated exonuclease gene 20kDa-like 1, Interferon-stimulated 20 kDa exonuclease-like 1, ISG20L1apoptosis-enhancing nuclease, pp12744 |
|---|
| Gene, Accession # | AEN, Gene ID: 64782, Accession: Q8WTP8, SwissProt: Q8WTP8 |
|---|
| Catalog # | NBP2-14272 |
|---|
| Price | |
|---|
| Order / More Info | Apoptosis enhancing nuclease Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|